
0/10 |
=-=-=-=
Registration Service Provided By: Namecheap.com
Contact: support@namecheap.com
Visit: http://namecheap.com
Domain name: bankfreedprepmastercardreview.net
Registrant Contact:
WhoisGuard
WhoisGuard Protected ()
Fax:
11400 W. Olympic Blvd. Suite 200
Los Angeles, CA 90064
US
Administrative Contact:
WhoisGuard
WhoisGuard Protected (5ec463872acb4617805fddb527e6cb0d.protect@whoisguard.com)
+1.6613102107
Fax: +1.6613102107
11400 W. Olympic Blvd. Suite 200
Los Angeles, CA 90064
US
Technical Contact:
WhoisGuard
WhoisGuard Protected (5ec463872acb4617805fddb527e6cb0d.protect@whoisguard.com)
+1.6613102107
Fax: +1.6613102107
11400 W. Olympic Blvd. Suite 200
Los Angeles, CA 90064
US
Status: Locked
Name Servers:
ns3515.hostgator.com
ns3516.hostgator.com
Creation date: 26 Oct 2011 03:05:00
Expiration date: 25 Oct 2012 19:05:00
=-=-=-=
The data in this whois database is provided to you for information
purposes only, that is, to assist you in obtaining information about or
related to a domain name registration record. We make this information
available "as is," and do not guarantee its accuracy. By submitting a
whois query, you agree that you will use this data only for lawful
purposes and that, under no circumstances will you use this data to: (1)
enable high volume, automated, electronic processes that stress or load
this whois database system providing you this information; or (2) allow,
enable, or otherwise support the transmission of mass unsolicited,
commercial advertising or solicitations via direct mail, electronic
mail, or by telephone. The compilation, repackaging, dissemination or
other use of this data is expressly prohibited without prior written
consent from us.
We reserve the right to modify these terms at any time. By submitting
this query, you agree to abide by these terms.
Version 6.3 4/3/2002